PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g01490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 180aa    MW: 21119.9 Da    PI: 8.1871
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g01490genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-182174457
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                + ++t+eq+++Le  F +++++  e++ +LAk+lg++ rq+ +W+qNrRa++k+
  CA10g01490 21 KKRLTQEQVKRLEISFDSTKKLEPEQKLQLAKELGVPPRQIAIWYQNRRARWKN 74
                5679************************************************95 PP

2HD-ZIP_I/II105.73.5e-3420111293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +k+rl++eqvk LE sF++++kLepe+K +la+eLg+ prq+a+W+qnrRAR+k++ lE dy+aL+ ++d+  +e++++eke+e L+ elk+
   CA10g01490  20 NKKRLTQEQVKRLEISFDSTKKLEPEQKLQLAKELGVPPRQIAIWYQNRRARWKNQSLELDYNALQLKLDTTLAEKKQIEKENELLKVELKK 111
                  79*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.5481575IPR001356Homeobox domain
SMARTSM003896.9E-151879IPR001356Homeobox domain
CDDcd000861.21E-132176No hitNo description
PfamPF000461.0E-152174IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-202182IPR009057Homeodomain-like
SuperFamilySSF466894.18E-172184IPR009057Homeodomain-like
PRINTSPR000313.1E-54655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000313.1E-55571IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MNNFLNSQYL HKHQSILNHN KKRLTQEQVK RLEISFDSTK KLEPEQKLQL AKELGVPPRQ  60
IAIWYQNRRA RWKNQSLELD YNALQLKLDT TLAEKKQIEK ENELLKVELK KVNEMLIAIK  120
QAQIQNELTQ GSSSFQEDVS CSWVNINNNN INNNNYNGSE SNLPLDEFYA CMKDMYDVY*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2547102e-70AC254710.5 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-57k18 map 10, complete sequence.
GenBankHG9754492e-70HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544740.11e-127PREDICTED: homeobox-leucine zipper protein HAT7-like
TrEMBLM1BWX41e-88M1BWX4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000548184e-88(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-25HD-ZIP family protein